Vial Guide
Human studiesGlucagon / GLP-1 dual agonist

Survodutide

BI 456906

Common dose
Up to 3.6–6 mg weekly (trials)
Cycle
Continuous
Vial sizes
10 mg
Typical draw
36 units10 mg with 1 mL, 3.6 mg

An investigational once-weekly injection that activates the glucagon and GLP-1 receptors. Like other GLP-1 drugs it curbs appetite; its glucagon action works mainly in the liver, where it cut liver fat in trials.

Evidence. Investigational (Boehringer Ingelheim; discovered with Zealand Pharma). In SYNCHRONIZE-1 (725 adults without diabetes) weight fell 12.2–13.0% at 76 weeks vs 5.4% on placebo, and in SYNCHRONIZE-2 (752 adults with type 2 diabetes) 8.2–9.8% vs 3.9%, counting everyone who started. Not approved anywhere and no filing announced as of early October 2026; trials in MASH (fatty liver with inflammation) continue.

Status

Approval
Not approved anywhere. Phase 3 obesity results came out in 2026 (SYNCHRONIZE-1 in June, SYNCHRONIZE-2 on October 1), and Boehringer Ingelheim had not announced a filing as of early October 2026. FDA has granted Fast Track and Breakthrough Therapy designations; MASH trials are ongoing.
Sport (WADA 2026)
Likely banned in sportNot named on WADA’s 2026 list, but its S0 rule bans drugs with no current human approval anywhere, at all times.

Sport status follows the WADA Prohibited List in force since January 1, 2026; athletes should confirm with their anti-doping organization. Checked October 5, 2026. Status of every compound.

How it works

Survodutide binds and switches on two receptors: GLP-1, which curbs appetite and slows stomach emptying, and glucagon, a hormone that acts mainly on the liver. It was designed after oxyntomodulin, a gut hormone that acts on both. In mice it cut weight more than semaglutide by raising energy use as well as lowering food intake; in people, falls in blood amino acids and glucagon showed both receptors were engaged.

TrialMainly from studies in people.

Not known

Whether the glucagon action raises energy use in people, as in mice, isn’t established. Glucagon can speed the heart, and a heart safety trial and a detailed heart-rhythm study are still under way.

Protocol

Trial

SYNCHRONIZE-1, NEJM 2026

Phase 3 maintenance doses of 3.6 or 6.0 mg once weekly, reached by stepping up from a low dose, with pauses or slower steps allowed for stomach side effects. At 76 weeks weight fell 12.2% and 13.0% vs 5.4% on placebo, counting everyone who started.

Trial

le Roux 2024

Phase 2 tested 0.6, 2.4, 3.6 and 4.8 mg weekly: 20 weeks of step-ups every 2 weeks, then 26 weeks at the assigned dose. Mean loss was 14.9% at 4.8 mg vs 2.8% on placebo.

Trial

Sanyal 2024

MASH (fatty liver with inflammation) phase 2: 2.4, 4.8 or 6.0 mg weekly for 48 weeks, including a 24-week fast step-up. MASH improved without worse scarring in 47%, 62% and 43% vs 14% on placebo.

Frequency
Once weekly
Route
Subcutaneous injection
Cycle
Continuous in trials (46–76 weeks).

Continuous, shown over 26 weeks

Common protocols

The ways Survodutide is most often run, each tagged with where it comes from.

Phase 3, 6.0 mg

Trial
Dose
6.0 mg
How often
Once weekly
How long
76 weeks

Stepped up from a low dose, with pauses allowed for stomach side effects. Mean loss 13.0% counting everyone who started (SYNCHRONIZE-1); 9.8% with type 2 diabetes (SYNCHRONIZE-2).

Draw 60 units10 mg + 1 mL

Phase 3, 3.6 mg

Trial
Dose
3.6 mg
How often
Once weekly
How long
76 weeks

Mean loss 12.2% counting everyone (SYNCHRONIZE-1); 8.2% with type 2 diabetes (SYNCHRONIZE-2).

Draw 36 units10 mg + 1 mL

Fatty liver (SYNCHRONIZE-MASLD)

Trial
Dose
6.0 mg
How often
Once weekly
How long
48 weeks

Adults with obesity and fatty liver with inflammation or scarring. Liver fat fell by 30% or more in 84.2% vs 24.3% on placebo, if everyone had stayed on treatment.

Draw 60 units10 mg + 1 mL

MASH phase 2

Trial
Dose
2.4, 4.8 or 6.0 mg
How often
Once weekly
How long
48 weeks

24 weeks of fast step-ups, then 24 weeks at the assigned dose. MASH improved without worse scarring in 43–62% vs 14% on placebo.

Taking it

Where it goes

Injected under the skin once a week in trials, from prefilled syringes. The belly, thigh or upper arm are the usual sites, rotated each week.

If you miss a dose

No label or published trial rule yet. Common practice is to take the next dose on schedule without doubling up. For comparison, the Wegovy label restarts at a lower dose after 2+ missed doses.

What to expect

  1. Step-up period

    Doses rise from a low start over several months. In phase 3, people with bad stomach symptoms could skip 1–2 doses, and after reaching 3.6 mg (up to week 32) could delay a step or drop one level for 2–4 weeks.

    Trial
  2. Week 46

    Phase 2: mean loss 14.9% on 4.8 mg vs 2.8% on placebo.

    Trial
  3. Week 48 (fatty liver)

    SYNCHRONIZE-MASLD: 84.2% had liver fat fall by 30% or more vs 24.3% on placebo, and weight fell 12.2% vs 1.0%, if everyone had stayed on treatment.

    Trial
  4. Week 76

    SYNCHRONIZE-1, counting everyone who started: 12.2% (3.6 mg) and 13.0% (6.0 mg) vs 5.4% on placebo. Boehringer reports up to 16.6% vs 3.2% if everyone had stayed on treatment.

    Trial

Side effects and what to do

GI side effects (SYNCHRONIZE-1: 81% at 3.6 mg, 90% at 6.0 mg vs 48% placebo)

Mostly mild to moderate and during step-ups. The trials paused doses or slowed the step-up when needed.

Nausea 66%, diarrhea 49%, vomiting 41% (MASH phase 2, all doses; placebo 23%, 23%, 4%)

That trial used fast step-ups. Ongoing vomiting or diarrhea needs medical advice; stay hydrated.

Stopping because of GI side effects (19% vs 2.9% in SYNCHRONIZE-1; 18% vs 1.2% in SYNCHRONIZE-2)

Most stopped during the step-up phase.

Heart and blood-vessel side effects (phase 1: 6 of 80 people stopped for them during a 6-week step-up)

Report palpitations, a racing pulse at rest or dizziness.

Stop and get medical help

Severe belly pain that won’t go away, signs of allergy, a racing heart at rest or fainting, or dehydration (dizziness, very little urine). Get medical help.

Who should avoid it

No product label covers survodutide, so these come from human studies and from precautions based on how it works. Most important first.

History of medullary thyroid cancer or MEN 2
TrialExcluded from SYNCHRONIZE-1, including a family history; MEN 2 is an inherited tumor syndrome. Approved GLP-1 drugs such as semaglutide are ruled out for this group because of thyroid C-cell tumors in rodents.
History of pancreatitis
TrialExcluded from SYNCHRONIZE-1, as were people with raised pancreatic enzymes. Pancreatitis, sometimes fatal, is a listed risk of approved GLP-1 drugs such as semaglutide.
Severe gastroparesis or stomach outlet blockage
TrialExcluded from SYNCHRONIZE-1. In that trial, stomach and gut side effects affected 81–90% of people on survodutide vs 48% on placebo.
Severe heart failure or a fast heartbeat
TrialSYNCHRONIZE-1 excluded the most severe heart failure. In Phase 1, 6 of 80 people stopped for heart or blood-vessel side effects during a fast step-up; a heart safety trial is ongoing.
Pregnancy or breastfeeding
PrecautionNo human safety data exist.
Anyone relying on product quality
PrecautionIt isn’t approved anywhere, so vials sold online have no regulated standard for identity, purity or sterility, and none has been tested in a trial.

Interactions

No interaction studies have been published, and no product label lists any.

Trial: seen in human studies, or a group those studies left out. Precaution: follows from how it works or from a related drug, and hasn’t been tested. This isn’t a complete list: a pharmacist or doctor can check a specific medicine or condition.

Tracking and pairing

Worth tracking

  • Resting heart rate
  • Kidney function if vomiting or diarrhea is heavy
  • Blood sugar if you use insulin or a sulfonylurea
  • Liver enzymes

Often paired with

Usually run on its own.

Human studies

5 key published human studies, with how many people took part. Animal studies aren’t listed here.

  1. 2026725 people

    Weight fell 12.2% and 13.0% vs 5.4% on placebo in adults with obesity without diabetes; GI side effects in 80.9% and 89.7% vs 47.9%.

    Design
    Randomized double-blind placebo-controlled trial (phase 3)
    Dose
    3.6 or 6.0 mg weekly
    Length
    76 weeks

    le Roux et al., N Engl J Med 2026 (SYNCHRONIZE-1), PMID 42253238

  2. 2026752 people

    In adults with obesity and type 2 diabetes, weight fell 8.2% and 9.8% vs 3.9% on placebo, and HbA1c 0.9 and 0.8 points vs 0.2.

    Design
    Randomized double-blind placebo-controlled trial (phase 3)
    Dose
    3.6 or 6.0 mg weekly
    Length
    76 weeks

    Wharton et al., N Engl J Med 2026 (SYNCHRONIZE-2), PMID 42820639

  3. 2026216 people

    In obesity with at-risk fatty liver, liver fat fell 30% or more in 68.5% vs 28.6% on placebo and weight fell 8.7% vs 1.4%, counting everyone who started.

    Design
    Randomized double-blind placebo-controlled trial (phase 3)
    Dose
    6.0 mg weekly
    Length
    48 weeks

    Kaplan et al., Nat Med 2026 (SYNCHRONIZE-MASLD), PMID 42252333

  4. 2024293 people

    MASH improved without worse fibrosis in 47%, 62% and 43% vs 14% on placebo in biopsy-proven MASH with F1–F3 fibrosis.

    Design
    Randomized double-blind placebo-controlled trial (phase 2)
    Dose
    2.4, 4.8 or 6.0 mg weekly
    Length
    48 weeks

    Sanyal et al., N Engl J Med 2024, PMID 38847460

  5. 2024387 people

    Weight fell 6.2%, 12.5%, 13.2% and 14.9% vs 2.8% on placebo in adults with overweight or obesity without diabetes.

    Design
    Randomized double-blind placebo-controlled dose-finding trial (phase 2)
    Dose
    0.6, 2.4, 3.6 or 4.8 mg weekly
    Length
    46 weeks

    le Roux et al., Lancet Diabetes Endocrinol 2024, PMID 38330987

All human studies on Vial Guide

Limits of the evidence

Phase 3 results so far cover about 1,700 adults treated for 48–76 weeks in three trials, plus Phase 2 trials in obesity and MASH (fatty liver with inflammation). The heart safety trial, a detailed heart-rhythm study and MASH outcome trials are still running, and the Phase 3 step-up schedule hasn’t been published in detail. Nothing is known about products or dosing outside the trials.

Mixing your vial

VialWaterCommon doseDrawStrengthAction
10 mg1 mL3.6 mg36 units (0.36 mL)10 mg/mL

No branded product exists; phase 3 trials used prefilled syringes. With 1 mL of water in a 10 mg vial, each 10 units holds 1 mg, so 3.6 mg is 36 units.

Dose chart

10 mg vial

Syringe units for common doses at different water volumes. Select a cell to open it in the calculator.

DoseWater added
1 mL2 mL3 mL
0.6 mg
1 mg
1.5 mg
2.5 mg
3.6 mg
4 mg
6 mg

U-100 insulin syringe: 100 units is 1 mL. Draws over 100 units show in mL. Faded values are under 2 units, which is hard to measure. Check that your vial holds the larger volumes.

Datasheet

Half-life
No reliable value has been published.
Type
Peptide, 29 amino acids
Molecular weight
4,231.7 g/mol
Formula
C192H289N47O61
Sequence
HXQGTFTSDYSKYLDERAAKDFIKWLESA-NH2X = 1-aminocyclobutane-1-carboxylic acid; Lys24 carries a C18 fatty diacid through a γGlu–Gly–Ser–Gly–Ser–Gly–Gly linker
Storage before use
Freezer for long-term storage; keep the vial sealed, dry and out of light.
After mixing or opening
Fridge (2–8 °C) after mixing; use within about 4 weeks.
  • Molecule: KEGG D12898 (sequence, linker, formula; MW 4231.63); PubChem CID 171378821 (structure)
  • Storage: Community Common community practice; no label or manufacturer storage data exist for this compound.

Every compound side by side: the half-life chart and the storage chart.

Cautions

  • Investigational and not approved anywhere; long-term safety is still being studied.
  • Stomach side effects are very common: 81–90% on survodutide vs 48% on placebo in SYNCHRONIZE-1, mostly during the step-up.
  • About 1 in 5 stopped because of GI side effects in phase 3 (19% vs 2.9% on placebo in SYNCHRONIZE-1; 18% vs 1.2% in SYNCHRONIZE-2).
  • Phase 1 and 2 trials stepped the dose up every 2 weeks and side effects clustered then; phase 3 stepped up less often, with pauses allowed. The phase 3 step schedule hasn’t been published in detail.

Questions

What is survodutide?

An investigational once-weekly injection that activates the glucagon and GLP-1 receptors. Like other GLP-1 drugs it curbs appetite; its glucagon action works mainly in the liver, where it cut liver fat in trials.

How does survodutide work?

Survodutide binds and switches on two receptors: GLP-1, which curbs appetite and slows stomach emptying, and glucagon, a hormone that acts mainly on the liver. It was designed after oxyntomodulin, a gut hormone that acts on both. In mice it cut weight more than semaglutide by raising energy use as well as lowering food intake; in people, falls in blood amino acids and glucagon showed both receptors were engaged. Whether the glucagon action raises energy use in people, as in mice, isn’t established. Glucagon can speed the heart, and a heart safety trial and a detailed heart-rhythm study are still under way.

Is survodutide FDA-approved?

Not approved anywhere. Phase 3 obesity results came out in 2026 (SYNCHRONIZE-1 in June, SYNCHRONIZE-2 on October 1), and Boehringer Ingelheim had not announced a filing as of early October 2026. FDA has granted Fast Track and Breakthrough Therapy designations; MASH trials are ongoing.

What is the usual survodutide dose?

From human studies (SYNCHRONIZE-1, NEJM 2026): Phase 3 maintenance doses of 3.6 or 6.0 mg once weekly, reached by stepping up from a low dose, with pauses or slower steps allowed for stomach side effects. At 76 weeks weight fell 12.2% and 13.0% vs 5.4% on placebo, counting everyone who started. le Roux 2024: Phase 2 tested 0.6, 2.4, 3.6 and 4.8 mg weekly: 20 weeks of step-ups every 2 weeks, then 26 weeks at the assigned dose. Mean loss was 14.9% at 4.8 mg vs 2.8% on placebo. These are the amounts sources reference, not recommendations.

How much water do I mix survodutide with?

There’s no single right amount, because the water only sets the strength. With 1 mL of bacteriostatic water in a 10 mg vial, the strength is 10 mg/mL, so 3.6 mg is 36 units on a U-100 insulin syringe. More water makes small doses easier to measure. The dose chart above shows other volumes.

Who should avoid survodutide?

No product label covers survodutide, so these come from human studies and from precautions based on how it works. History of medullary thyroid cancer or MEN 2: Excluded from SYNCHRONIZE-1, including a family history; MEN 2 is an inherited tumor syndrome. Approved GLP-1 drugs such as semaglutide are ruled out for this group because of thyroid C-cell tumors in rodents. History of pancreatitis: Excluded from SYNCHRONIZE-1, as were people with raised pancreatic enzymes. Pancreatitis, sometimes fatal, is a listed risk of approved GLP-1 drugs such as semaglutide. Severe gastroparesis or stomach outlet blockage: Excluded from SYNCHRONIZE-1. In that trial, stomach and gut side effects affected 81–90% of people on survodutide vs 48% on placebo. The “Who should avoid it” section lists 3 more groups.

How should survodutide be stored?

Before mixing: Freezer for long-term storage; keep the vial sealed, dry and out of light. Fridge (2–8 °C) after mixing; use within about 4 weeks. This is common practice; no product label covers it.

Is survodutide banned in sport?

Probably. Not named on WADA’s 2026 list, but its S0 rule bans drugs with no current human approval anywhere, at all times.

Has survodutide been studied in people?

Yes. The human studies section lists 5 published studies. The largest, from 2026, included 752 people. In adults with obesity and type 2 diabetes, weight fell 8.2% and 9.8% vs 3.9% on placebo, and HbA1c 0.9 and 0.8 points vs 0.2.

Sources

  • le Roux et al., survodutide for obesity, SYNCHRONIZE-1 (NEJM 2026) PMID 42253238
  • Wharton et al., survodutide in obesity with type 2 diabetes, SYNCHRONIZE-2 (NEJM 2026) PMID 42820639
  • le Roux et al., phase 2 obesity trial (Lancet Diabetes Endocrinol 2024) PMID 38330987
  • Sanyal et al., phase 2 trial in MASH and fibrosis (NEJM 2024) PMID 38847460

For the protocol details

  • Wharton et al., design of SYNCHRONIZE-1 and -2, including the step-up rules (Obesity 2025) PMID 39495965
  • Kaplan et al., SYNCHRONIZE-MASLD (Nat Med 2026) PMID 42252333
  • Jungnik et al., phase I studies of BI 456906 (Diabetes Obes Metab 2023) PMID 36527386
  • Boehringer Ingelheim: SYNCHRONIZE-1 and SYNCHRONIZE-MASLD results (June 2026) and SYNCHRONIZE-2 results (October 2026)

For how it works, who should avoid it and the limits of the evidence

  • Zimmermann et al., discovery and animal pharmacology of survodutide (Mol Metab 2022) PMID 36356832
  • SYNCHRONIZE-1 eligibility criteria (US trial registry entry) NCT06066515
  • Kushner and Michos, heart effects of glucagon and GLP-1 dual agonists, review (J Am Heart Assoc 2026) PMID 42535526
  • Wegovy prescribing information, boxed warning and section 5, for class warnings (Novo Nordisk, DailyMed, rev. 06/2026)