Vial Guide
Human studiesAntimicrobial host-defense peptide

LL-37

Cathelicidin LL-37, hCAP-18 fragment, ropocamptide

Common dose
0.5 mg/mL on ulcers, 2× weekly (trials)
Cycle
No set cycle
Vial sizes
5 mg

The only cathelicidin humans make: a 37-amino-acid peptide cut from a larger protein (hCAP-18) in white blood cells and skin. It kills bacteria and other microbes, signals immune cells and takes part in wound repair.

Evidence. Human trials have all been local: applied to leg and foot ulcers, and injected into melanoma tumors in 3 patients. A 34-person leg-ulcer trial looked promising, but the 148-person Phase 2b follow-up found no benefit overall, and the developer entered voluntary liquidation in October 2023. Never approved.

Status

Approval
Not approved as a drug in the US or EU.
US compounding
Nomination withdrawn, so no longer in FDA Category 2 (April 2026), and not on the July 2026 advisory committee agenda. FDA had cited possible immune reactions, too little human safety data, and lab and animal findings of harm to male reproduction and of tumor promotion in some tissues.
Sport (WADA 2026)
Likely banned in sportNot named on the 2026 list. It has no approval from any health authority, so it falls under S0 (non-approved substances), banned at all times.

Category 2 is FDA’s list of bulk substances that may present significant safety risks in compounding. The 503A bulks list adds substances that pharmacies may compound with. Advisory committee votes are advice; FDA makes the final decision. Sport status follows the WADA Prohibited List in force since January 1, 2026; athletes should confirm with their anti-doping organization. Checked October 5, 2026. Status of every compound.

How it works

LL-37 is the 37-amino-acid peptide cut from hCAP-18, the only cathelicidin humans make. It breaks up the outer membranes of bacteria, and in cell and animal work it also signals through FPR2, a receptor on immune cells and blood vessel lining, drawing cells into a wound and prompting new vessels. The same signaling, when skin levels run high, is tied to the inflammation of rosacea and psoriasis.

AnimalMainly from cell and animal studies; not shown in people.

Not known

No human study has measured what it does inside the body: the trials put it on ulcers or into tumors. Its effects on healthy tissue, and over time, are unknown.

Protocol

Trial

Grönberg 2014

Applied to venous leg ulcers twice weekly for 4 weeks at 0.5, 1.6 or 3.2 mg/mL; 0.5 mg/mL did best and 3.2 mg/mL no better than placebo.

Trial

HEAL LL-37, 2021

Phase 2b: 0.5 or 1.6 mg/mL on leg ulcers, with compression bandaging; no benefit over placebo overall.

Trial

NCT02225366

Injected into melanoma skin tumors at 250–500 mcg per tumor weekly, for up to 8 weeks (3 patients treated).

Frequency
Twice weekly (trials, on ulcers)
Route
Applied to ulcers or injected into tumors (trials); subcutaneous injection (community)
Cycle
No established cycle. Ulcer trials treated for 4 weeks or longer.

No set cycle, shown over 26 weeks

Common protocols

The ways LL-37 is most often run, each tagged with where it comes from.

Leg ulcer (Phase 1/2)

Trial
Dose
0.5 mg/mL (1.6 and 3.2 mg/mL also tested)
How often
Twice weekly, applied to the ulcer
How long
4 weeks

34 people. Healing rate about 6× placebo at 0.5 mg/mL and 3× at 1.6 mg/mL; the Phase 2b follow-up in 148 people didn’t confirm a benefit overall.

Diabetic foot ulcer

Trial
Dose
0.5 mg/mL cream
How often
Twice weekly
How long
4 weeks

New healing tissue (granulation) grew more than with placebo, but bacteria counts and inflammation markers didn’t fall more (Miranda 2023).

Melanoma (into tumors)

Trial
Dose
250–500 mcg per tumor
How often
Weekly
How long
Up to 8 weeks

Early dose-finding study. Only 3 patients were treated and one stopped for lack of benefit; results exist only on the trial registry.

Taking it

Where it goes

Trials applied it directly to cleaned ulcers or injected it into skin tumors. Community use is injection under the skin, rotating sites.

If you miss a dose

No published guidance. Skip the missed dose and resume the usual schedule; don’t double up.

What to expect

  1. 4 weeks (leg ulcers)

    Mean ulcer area fell 68% at 0.5 mg/mL and 50% at 1.6 mg/mL, with healing rates about 6× and 3× placebo (Grönberg 2014, 34 people).

    Trial
  2. Phase 2b (leg ulcers)

    In 148 people, healing was no better than placebo overall; a later analysis found benefit only in large ulcers (10 cm² or more).

    Trial
  3. Days 7–28 (foot ulcers)

    Granulation tissue grew more than with placebo at every weekly check (p=0.006–0.037).

    Trial

Side effects and what to do

No local or whole-body safety concerns in the ulcer trials (2014, 2021)

These trials put it on wounds; injected use hasn’t been studied for safety.

Possible immune reaction to injected peptide (FDA concern)

Stop and get care for hives, swelling or trouble breathing.

Skin flare in rosacea or psoriasis (theoretical: high LL-37 levels are linked to both)

Stop if a rash or flare appears.

Injection-site redness or soreness (any injected peptide)

Rotate sites. Spreading redness, heat or pus needs medical care.

Stop and get medical help

Hives, face or throat swelling or trouble breathing; fever with a hot, spreading red injection site; or a new or changing skin lump.

Who should avoid it

No product label covers LL-37, so these come from human studies and from precautions based on how it works. Most important first.

Anyone with cancer, or cancer within five years
TrialThe ulcer trials excluded malignant disease unless in remission five years; in lab work it makes some cancer cells grow or move, and FDA cited tumor promotion in animals.
Anyone injecting it
PrecautionNo human study has given it by injection into the body, and FDA cited possible immune reactions and too little human safety data.
Pregnancy or breastfeeding
TrialExcluded from the ulcer trials, which required contraception or post-menopausal status, and no human safety data cover it.
Anyone trying to conceive
PrecautionFDA cited animal and laboratory findings of harm to male reproduction, and LL-37 kills sperm in laboratory tests.
Rosacea or psoriasis
TrialHigh levels in skin are linked to the inflammation of both, and the leg ulcer trial excluded active psoriasis beside the ulcer.
Anyone taking immune-suppressing drugs
TrialThe Phase 2b ulcer trial excluded them, allowing only low-dose steroids, so those combinations are untested.

Interactions

No interaction studies have been published, and no product label lists any. The ulcer trials excluded systemic antibiotics in the week before screening and topical antibiotics on the treated ulcer, so those combinations are untested.

Trial: seen in human studies, or a group those studies left out. Precaution: follows from how it works or from a related drug, and hasn’t been tested. This isn’t a complete list: a pharmacist or doctor can check a specific medicine or condition.

Tracking and pairing

Worth tracking

  • Injection-site reactions
  • Skin flares if you have rosacea or psoriasis
  • Any new or changing skin lump

Often paired with

Usually run on its own.

Human studies

4 key published human studies, with how many people took part. Animal studies aren’t listed here.

  1. 2021148 people

    Healing was no better than placebo in the whole group; a post hoc look found significant improvement only in ulcers of 10 cm² or more. Both strengths were well tolerated.

    Design
    Randomized double-blind placebo-controlled Phase 2b trial (HEAL LL-37)
    Dose
    0.5 or 1.6 mg/mL applied to venous leg ulcers, with compression therapy
    Length
    13 weeks, after a 3-week placebo run-in

    Mahlapuu et al., Wound Repair Regen 2021, PMID 34687253

  2. 201434 people

    Healing-rate constants were about 6× (p=0.003) and 3× (p=0.088) placebo at 0.5 and 1.6 mg/mL, with mean ulcer area down 68% and 50%; 3.2 mg/mL did no better than placebo; no safety concerns.

    Design
    Randomized double-blind placebo-controlled first-in-human trial, after a 3-week placebo run-in
    Dose
    0.5, 1.6 or 3.2 mg/mL applied twice weekly to venous leg ulcers
    Length
    4 weeks, plus 4 weeks follow-up

    Grönberg et al., Wound Repair Regen 2014, PMID 25041740

  3. 2023

    The granulation index rose more than with placebo on days 7, 14, 21 and 28 (p=0.031, 0.009, 0.006, 0.037), but IL-1α, TNF-α and bacterial counts didn’t fall more.

    Design
    Randomized double-blind placebo-controlled trial (40 planned in the registry)
    Dose
    LL-37 cream (0.5 mg/mL per the trial registration) twice weekly on mildly infected diabetic foot ulcers
    Length
    4 weeks

    Miranda et al., Arch Dermatol Res 2023, PMID 37480520

  4. 20203 people

    Only 3 patients were treated; one stopped for lack of efficacy, no serious adverse events were reported, and the response data posted to the registry are unclear.

    Design
    Single-arm open-label Phase 1/2 dose-finding study (4 enrolled)
    Dose
    250 or 500 mcg per tumor, injected weekly into skin or under-skin melanoma deposits
    Length
    Up to 8 weeks

    Posted registry results, NCT02225366

All human studies on Vial Guide

Limits of the evidence

All human exposure has been local. A 34-person dose-finding trial treated leg ulcers for 4 weeks; the 148-person Phase 2b treated them for 13 weeks and found no benefit overall; a small trial treated diabetic foot ulcers; three melanoma patients had it injected into tumors. The serious events in the Phase 2b were judged unrelated to it. Nothing systemic has been measured.

Mixing your vial

VialWaterCommon doseDrawStrengthAction
5 mg2 mL––2.5 mg/mL
There’s no established per-injection amount for LL-37, so the table shows strength only.

Datasheet

Half-life
No reliable value has been published.
Type
Peptide, 37 amino acids
Molecular weight
4,493.3 g/mol
Formula
C205H340N60O53
Sequence
[LL-37, 37 aa]
Storage before use
Freezer (about −20 °C) for long-term storage.
After mixing or opening
Fridge (2–8 °C); use within about 4 weeks.
  • Molecule: PubChem CID 16198951 (LL-37, INN ropocamptide, UNII 3DD771JO2H; PubChem rounds the weight to 4493); weight calculated from the formula
  • Storage: Community Common practice; no approved label exists for this peptide

Every compound side by side: the half-life chart and the storage chart.

Cautions

  • No established injected dose: the human trials applied it to ulcers or injected it into tumors.
  • FDA flagged possible immune reactions and impurities, too little human safety data, and lab and animal findings of harm to male reproduction and of tumor promotion in some tissues.
  • High LL-37 levels in the skin are linked to the inflammation of rosacea and psoriasis.
  • More isn’t better: in the first ulcer trial the strongest solution (3.2 mg/mL) did no better than placebo.
  • Likely banned in sport (WADA S0).

Questions

What is LL-37?

The only cathelicidin humans make: a 37-amino-acid peptide cut from a larger protein (hCAP-18) in white blood cells and skin. It kills bacteria and other microbes, signals immune cells and takes part in wound repair.

How does LL-37 work?

LL-37 is the 37-amino-acid peptide cut from hCAP-18, the only cathelicidin humans make. It breaks up the outer membranes of bacteria, and in cell and animal work it also signals through FPR2, a receptor on immune cells and blood vessel lining, drawing cells into a wound and prompting new vessels. The same signaling, when skin levels run high, is tied to the inflammation of rosacea and psoriasis. No human study has measured what it does inside the body: the trials put it on ulcers or into tumors. Its effects on healthy tissue, and over time, are unknown.

Is LL-37 FDA-approved?

Not approved as a drug in the US or EU. Nomination withdrawn, so no longer in FDA Category 2 (April 2026), and not on the July 2026 advisory committee agenda. FDA had cited possible immune reactions, too little human safety data, and lab and animal findings of harm to male reproduction and of tumor promotion in some tissues.

What is the usual LL-37 dose?

From human studies (Grönberg 2014): Applied to venous leg ulcers twice weekly for 4 weeks at 0.5, 1.6 or 3.2 mg/mL; 0.5 mg/mL did best and 3.2 mg/mL no better than placebo. Phase 2b: 0.5 or 1.6 mg/mL on leg ulcers, with compression bandaging; no benefit over placebo overall (HEAL LL-37, 2021). These are the amounts sources reference, not recommendations.

Who should avoid LL-37?

No product label covers LL-37, so these come from human studies and from precautions based on how it works. Anyone with cancer, or cancer within five years: The ulcer trials excluded malignant disease unless in remission five years; in lab work it makes some cancer cells grow or move, and FDA cited tumor promotion in animals. Anyone injecting it: No human study has given it by injection into the body, and FDA cited possible immune reactions and too little human safety data. Pregnancy or breastfeeding: Excluded from the ulcer trials, which required contraception or post-menopausal status, and no human safety data cover it. The “Who should avoid it” section lists 3 more groups.

How should LL-37 be stored?

Before mixing: Freezer (about −20 °C) for long-term storage. After mixing: Fridge (2–8 °C); use within about 4 weeks. This is common practice; no product label covers it.

Is LL-37 banned in sport?

Probably. Not named on the 2026 list. It has no approval from any health authority, so it falls under S0 (non-approved substances), banned at all times.

Has LL-37 been studied in people?

Yes. The human studies section lists 4 published studies. Among them, from 2021: Healing was no better than placebo in the whole group; a post hoc look found significant improvement only in ulcers of 10 cm² or more. Both strengths were well tolerated.

Sources

  • Grönberg et al., LL-37 for hard-to-heal venous leg ulcers (Wound Repair Regen 2014) PMID 25041740
  • Mahlapuu et al., HEAL LL-37 Phase 2b trial in venous leg ulcers (Wound Repair Regen 2021) PMID 34687253
  • Miranda et al., LL-37 cream for diabetic foot ulcers (Arch Dermatol Res 2023) PMID 37480520
  • FDA: bulk drug substances that may present significant safety risks, cathelicidin LL-37 (April 2026)

For the protocol details

  • Intratumoral LL-37 for melanoma, posted registry results (NCT02225366)

For how it works, who should avoid it and the limits of the evidence

  • Koczulla et al., an angiogenic role for LL-37 through formyl peptide receptor-like 1 (J Clin Invest 2003) PMID 12782669
  • Lande et al., LL-37 with self-DNA triggers interferon from dendritic cells (Nature 2007) PMID 17873860
  • FDA, certain bulk drug substances that may present significant safety risks, cathelicidin LL-37 entry (page content current April 22, 2026)
  • Intratumoral LL-37 for melanoma, posted registry record and results NCT02225366